Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACYBP Rabbit Polyclonal Antibody (Biotin)

CACYBP Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SIP, GIG5, PNAS-107, S100A6BP

UniProt

Q9HB71

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CACYBP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055227

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ahsg sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
11565114 3x 1.0 µg

Ahsg sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
PE/Dazzle™ 594 anti-mouse CD200 (OX2)
GT03139 25 µg

PE/Dazzle™ 594 anti-mouse CD200 (OX2)

Sign In for Pricing
View Details
CBY1 cDNA Clone
MBS1277727-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

CBY1 cDNA Clone

Sign In for Pricing
View Details
CBY1 cDNA Clone
MBS1277727-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

CBY1 cDNA Clone

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae LIP5 Protein (aa 19-414) [His] (strain JAY291)
VAng-Wyb4943-1mg 1 mg

Recombinant Saccharomyces Cerevisiae LIP5 Protein (aa 19-414) [His] (strain JAY291)

Sign In for Pricing
View Details
PLK4 Mouse Monoclonal Antibody [Clone:3B10]
E45M19719 100 µg

PLK4 Mouse Monoclonal Antibody [Clone:3B10]

Sign In for Pricing
View Details