Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNLL1 Rabbit Polyclonal Antibody (Biotin)

DYNLL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LC8, PIN, DLC1, DLC8, LC8a, DNCL1, hdlc1, DNCLC1

UniProt

P63167

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001032583

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S1PR3 Protein Lysate (Human) with C-Ha Tag
42956031 100 µg

S1PR3 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Lentiviral mouse Tex21 shRNA (UAS) - Lentiviral mouse Tex21 shRNA (UAS) (100)
GTR15131838 1 Vial

Lentiviral mouse Tex21 shRNA (UAS) - Lentiviral mouse Tex21 shRNA (UAS) (100)

Sign In for Pricing
View Details
Phospho-Akt (S473) Pan Specific Affinity Purified Pab
AF887-SP 25 µg

Phospho-Akt (S473) Pan Specific Affinity Purified Pab

Sign In for Pricing
View Details
FABP5L8 CRISPR Knock Out 293T Cell Line (Human)
57267141 1x 10^6 Cells / 1.0 mL

FABP5L8 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
BeyoIHCTM CA125 Rabbit Monoclonal Antibody
AG8156 50 µL

BeyoIHCTM CA125 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Acidic Cytokeratin Antibody / LMW / Type I
V4484-100UG 100 µg

Acidic Cytokeratin Antibody / LMW / Type I

Sign In for Pricing
View Details