Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNLL1 Rabbit Polyclonal Antibody (FITC)

DYNLL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LC8, PIN, DLC1, DLC8, LC8a, DNCL1, hdlc1, DNCLC1

UniProt

P63167

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001032583

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken double stranded DNA (ds-DNA) ELISA Kit
EIA06582Ch 1 Kit

Chicken double stranded DNA (ds-DNA) ELISA Kit

Sign In for Pricing
View Details
DNMT3A 293 Cell Lysate
405813 0.1 mg

DNMT3A 293 Cell Lysate

Sign In for Pricing
View Details
GOLGA2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
22356154 3x 1.0 µg DNA

GOLGA2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Ccnd1 antibody - C-terminal region
MBS3204837-01 0.1 mL

Ccnd1 antibody - C-terminal region

Sign In for Pricing
View Details
Ccnd1 antibody - C-terminal region
MBS3204837-02 5x 0.1 mL

Ccnd1 antibody - C-terminal region

Sign In for Pricing
View Details
HNRNPH3 Over-expression Lysate Product
GWB-9C5500 0.1 mg

HNRNPH3 Over-expression Lysate Product

Sign In for Pricing
View Details