Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fank1 Rabbit Polyclonal Antibody (HRP)

Fank1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FANK1S, AI850911, 1700007B22Rik

UniProt

Q9DAM9

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLLRILEGGHVMIDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_080126

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPAB4 Antibody
E19-9467-2 100 µg -100 µL

RPAB4 Antibody

Sign In for Pricing
View Details
Complement 4d (C4d, Acidic Complement C4, Basic C4, C4, C4-1, C4a Anaphylatoxin, C4A, C4A2, C4A3, C4A4, C4A6, C4b, C4B1, C4B12, C4d fragment, C4F, C4S, Complement C4 Gamma Chain, Complement Component 4A, Complement Component 4B) (HRP)
MBS6122978-01 0.1 mL

Complement 4d (C4d, Acidic Complement C4, Basic C4, C4, C4-1, C4a Anaphylatoxin, C4A, C4A2, C4A3, C4A4, C4A6, C4b, C4B1, C4B12, C4d fragment, C4F, C4S, Complement C4 Gamma Chain, Complement Component 4A, Complement Component 4B) (HRP)

Sign In for Pricing
View Details
Complement 4d (C4d, Acidic Complement C4, Basic C4, C4, C4-1, C4a Anaphylatoxin, C4A, C4A2, C4A3, C4A4, C4A6, C4b, C4B1, C4B12, C4d fragment, C4F, C4S, Complement C4 Gamma Chain, Complement Component 4A, Complement Component 4B) (HRP)
MBS6122978-02 5x 0.1 mL

Complement 4d (C4d, Acidic Complement C4, Basic C4, C4, C4-1, C4a Anaphylatoxin, C4A, C4A2, C4A3, C4A4, C4A6, C4b, C4B1, C4B12, C4d fragment, C4F, C4S, Complement C4 Gamma Chain, Complement Component 4A, Complement Component 4B) (HRP)

Sign In for Pricing
View Details
CTPS1 siRNA (Human)
CRH1063-01 15 nmol

CTPS1 siRNA (Human)

Sign In for Pricing
View Details
CTPS1 siRNA (Human)
CRH1063-02 30 nmol

CTPS1 siRNA (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal Symplekin Antibody [FITC]
NB100-74590F 0.1 mL

Rabbit Polyclonal Symplekin Antibody [FITC]

Sign In for Pricing
View Details