Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARK7 Rabbit Polyclonal Antibody (Biotin)

PARK7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DJ1, DJ-1, GATD2, HEL-S-67p

UniProt

Q99497

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PARK7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_009193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

0.25% Trypsin solution (with EDTA, phenol red, dissolved in D-Hank's)
MBS2564393-01 125 mL

0.25% Trypsin solution (with EDTA, phenol red, dissolved in D-Hank's)

Sign In for Pricing
View Details
0.25% Trypsin solution (with EDTA, phenol red, dissolved in D-Hank's)
MBS2564393-02 500 mL

0.25% Trypsin solution (with EDTA, phenol red, dissolved in D-Hank's)

Sign In for Pricing
View Details
0.25% Trypsin solution (with EDTA, phenol red, dissolved in D-Hank's)
MBS2564393-03 5x 500 mL

0.25% Trypsin solution (with EDTA, phenol red, dissolved in D-Hank's)

Sign In for Pricing
View Details
Interleukin 18 (Interleukin-18, IL-18, IL18, Interferon gamma-inducing Factor, IFN-gamma-inducing Factor, IGIF, Interleukin-1 gamma, IL-1 gamma, IL-1g) discontinued
I8439-95V 1 mL

Interleukin 18 (Interleukin-18, IL-18, IL18, Interferon gamma-inducing Factor, IFN-gamma-inducing Factor, IGIF, Interleukin-1 gamma, IL-1 gamma, IL-1g) discontinued

Sign In for Pricing
View Details
CBR3 Recombinant Rabbit mAb
BS49450-01 50 µL

CBR3 Recombinant Rabbit mAb

Sign In for Pricing
View Details
CBR3 Recombinant Rabbit mAb
BS49450-02 100 µL

CBR3 Recombinant Rabbit mAb

Sign In for Pricing
View Details