Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fzr1 Rabbit Polyclonal Antibody (FITC)

Fzr1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Fy, FZR, Fyr, Cdh1, FZR2, HCDH, HCDH1, AW108046

UniProt

Q9R1K5

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RQIIIQNENTVPCVSEMRRTLTPANSPVSSPSKHGDRFIPSRAGANWSVN

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_062731

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein L 1 (APOL1) Mouse Monoclonal Antibody [Clone ID: OTI1D8]
CF812042 100 µg

Apolipoprotein L 1 (APOL1) Mouse Monoclonal Antibody [Clone ID: OTI1D8]

Sign In for Pricing
View Details
Human LAG-3 Recombinant Rabbit Monoclonal Antibody [PSH05-29] - BSA and Azide free (Capture)
HA722258 100 µL

Human LAG-3 Recombinant Rabbit Monoclonal Antibody [PSH05-29] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
GPR31 Human Gene Knockout Kit (CRISPR)
KN420560 1 Kit

GPR31 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Iba1 Recombinant Chimeric Antibody Antibody
HA601376 100 µL

Iba1 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
WNT3A Rabbit Polyclonal Antibody
TA383335 100 µL

WNT3A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ALOX12P2 Human qPCR Primer Pair (NR_002710)
HP220097 200 Reactions

ALOX12P2 Human qPCR Primer Pair (NR_002710)

Sign In for Pricing
View Details