Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNNT3 Rabbit Polyclonal Antibody (HRP)

TNNT3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TNTF, DA2B2, beta-TnTF

UniProt

P45378

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TNNT3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QLEIDKFEFGEKLKRQKYDIMNVRARVQMLAKFSKKAGTPAKGKVGGRWK

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001036245

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UROD Rabbit pAb, IRDye 800CW conjugated
orb2825211 100 µL

UROD Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
STK35 Rabbit pAb, IRDye 800CW conjugated
orb2850097 100 µL

STK35 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Cofilin 1 (CFL1) (NM_005507) Human Tagged Lenti ORF Clone
RC203585L3 10 µg

Cofilin 1 (CFL1) (NM_005507) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Solute Carrier Family 6 Member 17 (SLC6A17) Antibody
abx007904-01 30 µL

Solute Carrier Family 6 Member 17 (SLC6A17) Antibody

Sign In for Pricing
View Details
Solute Carrier Family 6 Member 17 (SLC6A17) Antibody
abx007904-02 100 µL

Solute Carrier Family 6 Member 17 (SLC6A17) Antibody

Sign In for Pricing
View Details
Solute Carrier Family 6 Member 17 (SLC6A17) Antibody
abx007904-03 200 µL

Solute Carrier Family 6 Member 17 (SLC6A17) Antibody

Sign In for Pricing
View Details