Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNNT3 Rabbit Polyclonal Antibody (Biotin)

TNNT3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TNTF, DA2B2, beta-TnTF

UniProt

P45378

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TNNT3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001036245

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Arabinogalactan-Protein, AGP (monoclonal, clone JIM13)
AS22 4745-1ml 1 mL

Anti-Arabinogalactan-Protein, AGP (monoclonal, clone JIM13)

Sign In for Pricing
View Details
Cytokeratin 19 (A53-B/A2.26), CF640R conjugate, 0.1mg/mL
BNC400020-500 1x 500 µL

Cytokeratin 19 (A53-B/A2.26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Speer4f1 Mouse Gene Knockout Kit (CRISPR)
KN516588 1 Kit

Speer4f1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BCOR (NM_001123383) Human Over-expression Lysate
LC426616 20 µg

BCOR (NM_001123383) Human Over-expression Lysate

Sign In for Pricing
View Details
4,7-Difluoro-1,3-isobenzofurandione (Technical Grade, ~90%)
TRC-D446145-1G 1 g

4,7-Difluoro-1,3-isobenzofurandione (Technical Grade, ~90%)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS640088 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details