Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNNT3 Rabbit Polyclonal Antibody (FITC)

TNNT3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TNTF, DA2B2, beta-TnTF

UniProt

P45378

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TNNT3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001036245

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-Stx1a (mouse) -3xMyc-Neo
BZ62468 1 Vial

PCMV-Stx1a (mouse) -3xMyc-Neo

Sign In for Pricing
View Details
Fish Prealbumin (PA) ELISA Kit
MBS2802649-01 48 Tests

Fish Prealbumin (PA) ELISA Kit

Sign In for Pricing
View Details
Fish Prealbumin (PA) ELISA Kit
MBS2802649-02 96 Tests

Fish Prealbumin (PA) ELISA Kit

Sign In for Pricing
View Details
Fish Prealbumin (PA) ELISA Kit
MBS2802649-03 5x 96 Tests

Fish Prealbumin (PA) ELISA Kit

Sign In for Pricing
View Details
Fish Prealbumin (PA) ELISA Kit
MBS2802649-04 10x 96 Tests

Fish Prealbumin (PA) ELISA Kit

Sign In for Pricing
View Details
Monkey Host Cell Factor C1 Regulator 1 (HCFC1R1) ELISA Kit
MBS9916522-01 48 Well

Monkey Host Cell Factor C1 Regulator 1 (HCFC1R1) ELISA Kit

Sign In for Pricing
View Details