Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNNT3 Rabbit Polyclonal Antibody (FITC)

TNNT3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TNTF, DA2B2, beta-TnTF

UniProt

P45378

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TNNT3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001036245

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP24-1 (NM_001085455) Human Tagged ORF Clone
RG222727 10 µg

KRTAP24-1 (NM_001085455) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal IgG1 Fc Antibody (43D17) [mFluor Violet 500 SE]
NBP2-22028MFV500 0.1 mL

Mouse Monoclonal IgG1 Fc Antibody (43D17) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
TANK CRISPR Knock Out 293T Cell Line (Human)
46114141 1x 10^6 Cells / 1.0 mL

TANK CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
NME2 Antibody - middle region
ARP79100_P050-25UL 25 µL

NME2 Antibody - middle region

Sign In for Pricing
View Details
BC049715 Protein Lysate (Mouse) with C-HA Tag
13154034 100 µg

BC049715 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Human Heart Cytoplasmic Protein
HT-801-CYT 1 Each

Human Heart Cytoplasmic Protein

Sign In for Pricing
View Details