What is the catalog number for TNNT3 Rabbit Polyclonal Antibody (HRP)?

The catalog number for TNNT3 Rabbit Polyclonal Antibody (HRP) is orb2110748.

What sizes are available for TNNT3 Rabbit Polyclonal Antibody (HRP)?

TNNT3 Rabbit Polyclonal Antibody (HRP) is available in the following size(s): 100 µL.

Is TNNT3 Rabbit Polyclonal Antibody (HRP) in stock?

TNNT3 Rabbit Polyclonal Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

TNNT3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TNTF, DA2B2, beta-TnTF

UniProt

P45378

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TNNT3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.