Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNNT3 Rabbit Polyclonal Antibody (HRP)

TNNT3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TNTF, DA2B2, beta-TnTF

UniProt

P45378

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TNNT3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001036245

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ankrd2 shRNA (UAS) - Lentiviral mouse Ankrd2 shRNA (UAS, iRFP) plasmid
GTR15202660 1 Vial

Lentiviral mouse Ankrd2 shRNA (UAS) - Lentiviral mouse Ankrd2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
ATTO 565 iodacetamid
orb3133033-01 50 mg

ATTO 565 iodacetamid

Sign In for Pricing
View Details
ATTO 565 iodacetamid
orb3133033-02 10 mg

ATTO 565 iodacetamid

Sign In for Pricing
View Details
Phospho-HER4 (Tyr1162) Rabbit Polyclonal Antibody (Cy3)
orb982270 100 µL

Phospho-HER4 (Tyr1162) Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Mouse Calicin (CCIN) ELISA Kit
MBS7222222-01 48 Well

Mouse Calicin (CCIN) ELISA Kit

Sign In for Pricing
View Details
Mouse Calicin (CCIN) ELISA Kit
MBS7222222-02 96 Well

Mouse Calicin (CCIN) ELISA Kit

Sign In for Pricing
View Details