Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2ry1 Rabbit Polyclonal Antibody (FITC)

P2ry1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P2y, P2y1

UniProt

P49651

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VVAISPILFYSGTGIRKNKTVTCYDSTSDEYLRSYFIYSMCTTVAMFCIP

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036932

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r77 Protein Vector (Mouse) (pPM-C-His)
PV246361 500 ng

Vmn2r77 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
MBNL3, ID (MBNL3, CHCR, MBLX39, MBXL, Muscleblind-like protein 3, Cys3His CCG1-required protein, Muscleblind-like X-linked protein, Protein HCHCR) (MaxLight 750)
MBS6319406-01 0.1 mL

MBNL3, ID (MBNL3, CHCR, MBLX39, MBXL, Muscleblind-like protein 3, Cys3His CCG1-required protein, Muscleblind-like X-linked protein, Protein HCHCR) (MaxLight 750)

Sign In for Pricing
View Details
MBNL3, ID (MBNL3, CHCR, MBLX39, MBXL, Muscleblind-like protein 3, Cys3His CCG1-required protein, Muscleblind-like X-linked protein, Protein HCHCR) (MaxLight 750)
MBS6319406-02 5x 0.1 mL

MBNL3, ID (MBNL3, CHCR, MBLX39, MBXL, Muscleblind-like protein 3, Cys3His CCG1-required protein, Muscleblind-like X-linked protein, Protein HCHCR) (MaxLight 750)

Sign In for Pricing
View Details
Human LILRA1 qPCR Primer Pair
QH33069S 200 Tests

Human LILRA1 qPCR Primer Pair

Sign In for Pricing
View Details
Human Proprotein Convertase Subtilisin/Kexin Type 2 (PCSK2) ELISA Kit
MBS456120-01 48 Tests

Human Proprotein Convertase Subtilisin/Kexin Type 2 (PCSK2) ELISA Kit

Sign In for Pricing
View Details
Human Proprotein Convertase Subtilisin/Kexin Type 2 (PCSK2) ELISA Kit
MBS456120-02 96 Tests

Human Proprotein Convertase Subtilisin/Kexin Type 2 (PCSK2) ELISA Kit

Sign In for Pricing
View Details