Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C16orf48 Rabbit Polyclonal Antibody (HRP)

C16orf48 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FBB11, C16orf48, DAKV6410

UniProt

Q9H0I2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C16orf48

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SQLLRELVLLPAGADSLRAQSHRAELDRKLVQVEEAIKIFSRPKVFVKMD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115516

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC6 (Histone Deacetylase 6, FLJ16239, HD6, JM21) (PE)
MBS6186832-01 0.1 mL

HDAC6 (Histone Deacetylase 6, FLJ16239, HD6, JM21) (PE)

Sign In for Pricing
View Details
HDAC6 (Histone Deacetylase 6, FLJ16239, HD6, JM21) (PE)
MBS6186832-02 5x 0.1 mL

HDAC6 (Histone Deacetylase 6, FLJ16239, HD6, JM21) (PE)

Sign In for Pricing
View Details
Multiplex Assay Kit for Huntingtin (HTT), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0031356 96 Tests

Multiplex Assay Kit for Huntingtin (HTT), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
FUS (NM_004960) Human Mass Spec Standard
PH301808 10 µg

FUS (NM_004960) Human Mass Spec Standard

Sign In for Pricing
View Details
Human Ribophorin I (RPN1) ELISA Kit
MBS452886-01 48 Tests

Human Ribophorin I (RPN1) ELISA Kit

Sign In for Pricing
View Details
Human Ribophorin I (RPN1) ELISA Kit
MBS452886-02 96 Tests

Human Ribophorin I (RPN1) ELISA Kit

Sign In for Pricing
View Details