Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEG10 Rabbit Polyclonal Antibody (HRP)

PEG10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EDR, HB-1, Mar2, RTL2, MEF3L, Mart2, RGAG3, SIRH1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PEG10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLY

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001165909

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mkl2 (NM_181860) Mouse Tagged ORF Clone Lentiviral Particle
MR200325L3V 200 µL

Mkl2 (NM_181860) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Taar8b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3154905 3x 1.0 µg

Taar8b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rice Putative receptor protein kinase Monoclonal Mouse Monoclonal Antibody
orb2956242-01 50 µg

Rice Putative receptor protein kinase Monoclonal Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Rice Putative receptor protein kinase Monoclonal Mouse Monoclonal Antibody
orb2956242-02 100 µg

Rice Putative receptor protein kinase Monoclonal Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Prostaglandin F2α ethyl amide
orb2283578-01 50 mg

Prostaglandin F2α ethyl amide

Sign In for Pricing
View Details
Prostaglandin F2α ethyl amide
orb2283578-02 10 mg

Prostaglandin F2α ethyl amide

Sign In for Pricing
View Details