Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEG10 Rabbit Polyclonal Antibody (Biotin)

PEG10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EDR, HB-1, Mar2, RTL2, MEF3L, Mart2, RGAG3, SIRH1

UniProt

Q86TG7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PEG10

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SMMTGRAARWASAKLERSHYLMHNYPAFMMEMKHVFEDPQRREVAKRKIR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_055883

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Monoclonal EGFR Antibody (Matuzumab) [Alexa Fluor 532]
NBP2-75911AF532 0.1 mL

Human Monoclonal EGFR Antibody (Matuzumab) [Alexa Fluor 532]

Sign In for Pricing
View Details
YL1 (VPS72) Human Gene Knockout Kit (CRISPR)
KN401273 1 Kit

YL1 (VPS72) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AQP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV699975 1.0 µg DNA

AQP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
1- (4-Hydroxyphenyl) -2,4,6-triphenylpyridinium hydroxide inner salt
sc-213264 500 mg

1- (4-Hydroxyphenyl) -2,4,6-triphenylpyridinium hydroxide inner salt

Sign In for Pricing
View Details
OXA1L (Mitochondrial Inner Membrane Protein OXA1L, Hsa, OXA1Hs, Oxidase Assembly 1-like Protein, OXA1-like Protein)
MBS6006369-01 0.1 mg

OXA1L (Mitochondrial Inner Membrane Protein OXA1L, Hsa, OXA1Hs, Oxidase Assembly 1-like Protein, OXA1-like Protein)

Sign In for Pricing
View Details
OXA1L (Mitochondrial Inner Membrane Protein OXA1L, Hsa, OXA1Hs, Oxidase Assembly 1-like Protein, OXA1-like Protein)
MBS6006369-02 5x 0.1 mg

OXA1L (Mitochondrial Inner Membrane Protein OXA1L, Hsa, OXA1Hs, Oxidase Assembly 1-like Protein, OXA1-like Protein)

Sign In for Pricing
View Details