Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEG10 Rabbit Polyclonal Antibody (Biotin)

PEG10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EDR, HB-1, Mar2, RTL2, MEF3L, Mart2, RGAG3, SIRH1

UniProt

Q86TG7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PEG10

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SMMTGRAARWASAKLERSHYLMHNYPAFMMEMKHVFEDPQRREVAKRKIR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_055883

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTUD7A, NT (OTUD7A, C15orf16, CEZANNE2, OTUD7, OTU domain-containing protein 7A, Zinc finger protein Cezanne 2) (MaxLight 750) discontinued
039542-ML750 100 µL

OTUD7A, NT (OTUD7A, C15orf16, CEZANNE2, OTUD7, OTU domain-containing protein 7A, Zinc finger protein Cezanne 2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
ANGPTL3, NT (Angiopoietin-related Protein 3, Angiopoietin-like Protein 3, Angiopoietin-5, ANG-5, UNQ153/PRO179, ANGPT5) (FITC) discontinued
A2293-48K-FITC 200 µL

ANGPTL3, NT (Angiopoietin-related Protein 3, Angiopoietin-like Protein 3, Angiopoietin-5, ANG-5, UNQ153/PRO179, ANGPT5) (FITC) discontinued

Sign In for Pricing
View Details
Ccdc93 ORF Vector (Rat) (pORF)
15332016 1.0 µg DNA

Ccdc93 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Recombinant Silicibacter sp. Integration host factor subunit beta (ihfB)
MBS1454685-01 0.02 mg (E-Coli)

Recombinant Silicibacter sp. Integration host factor subunit beta (ihfB)

Sign In for Pricing
View Details
Recombinant Silicibacter sp. Integration host factor subunit beta (ihfB)
MBS1454685-02 0.1 mg (E-Coli)

Recombinant Silicibacter sp. Integration host factor subunit beta (ihfB)

Sign In for Pricing
View Details
Recombinant Silicibacter sp. Integration host factor subunit beta (ihfB)
MBS1454685-03 0.02 mg (Yeast)

Recombinant Silicibacter sp. Integration host factor subunit beta (ihfB)

Sign In for Pricing
View Details