Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wasf2 Rabbit Polyclonal Antibody (Biotin)

Wasf2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

WAV, WAVE2, AW742646, D4Ertd13, D4Ertd13e

UniProt

Q8BH43

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ALKFYTNPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRK

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_700472

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Collagen Type XIX (COL19)
TRV-0057343-01 20 µL

Polyclonal Antibody to Collagen Type XIX (COL19)

Sign In for Pricing
View Details
Polyclonal Antibody to Collagen Type XIX (COL19)
TRV-0057343-02 100 µL

Polyclonal Antibody to Collagen Type XIX (COL19)

Sign In for Pricing
View Details
Polyclonal Antibody to Collagen Type XIX (COL19)
TRV-0057343-03 200 µL

Polyclonal Antibody to Collagen Type XIX (COL19)

Sign In for Pricing
View Details
Polyclonal Antibody to Collagen Type XIX (COL19)
TRV-0057343-04 1 mL

Polyclonal Antibody to Collagen Type XIX (COL19)

Sign In for Pricing
View Details
Cadm1 Rat Pre-designed siRNA Set A
HY-RS24444 1 Set

Cadm1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
APEX1 (DNA- (Apurinic or Apyrimidinic Site) Lyase, APEX Nuclease, APEN, Apurinic-apyrimidinic Endonuclease 1, AP Endonuclease 1, APE-1, REF-1, Redox Factor-1, APE, APE1, APEX, APX, HAP1, REF1)
123395 50 µg

APEX1 (DNA- (Apurinic or Apyrimidinic Site) Lyase, APEX Nuclease, APEN, Apurinic-apyrimidinic Endonuclease 1, AP Endonuclease 1, APE-1, REF-1, Redox Factor-1, APE, APE1, APEX, APX, HAP1, REF1)

Sign In for Pricing
View Details