Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wasf2 Rabbit Polyclonal Antibody (FITC)

Wasf2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

WAV, WAVE2, AW742646, D4Ertd13, D4Ertd13e

UniProt

Q8BH43

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ALKFYTNPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRK

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_700472

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Prolactin-releasing peptide (PRLH) ELISA Kit
AE25898BO-01 48 Tests

Bovine Prolactin-releasing peptide (PRLH) ELISA Kit

Sign In for Pricing
View Details
Bovine Prolactin-releasing peptide (PRLH) ELISA Kit
AE25898BO-02 96 Tests

Bovine Prolactin-releasing peptide (PRLH) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Sema4f shRNA (UAS) - Lentiviral mouse Sema4f shRNA (UAS, iRFP) (100)
GTR15242607 1 Vial

Lentiviral mouse Sema4f shRNA (UAS) - Lentiviral mouse Sema4f shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Picalm ORF Vector (Mouse) (pORF)
ORF053997 1.0 µg DNA

Picalm ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
HSPA1B (Heat Shock 70kD Protein 1A/1B, Heat Shock 70kD Protein 1B)
483165 100 µL

HSPA1B (Heat Shock 70kD Protein 1A/1B, Heat Shock 70kD Protein 1B)

Sign In for Pricing
View Details
Defb45 Protein Vector (Mouse) (pPB-C-His)
PV171570 500 ng

Defb45 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details