Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wasf2 Rabbit Polyclonal Antibody (Biotin)

Wasf2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

WAV, WAVE2, AW742646, D4Ertd13, D4Ertd13e

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QNGSIGSVENVDAASYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPADN

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_700472

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF217 qPCR Primer Pair
QH25329S 200 Tests

Human ZNF217 qPCR Primer Pair

Sign In for Pricing
View Details
Pro Caspase 3 Rabbit mAb
E60M1125 100 µL

Pro Caspase 3 Rabbit mAb

Sign In for Pricing
View Details
SLC17A2 Blocking Peptide
33R-9612 0.1 mg

SLC17A2 Blocking Peptide

Sign In for Pricing
View Details
POR Antibody
orb1338299 100 µg

POR Antibody

Sign In for Pricing
View Details
dsg3 Double Nickase Plasmid (m2)
sc-420068-NIC-2 20 µg

dsg3 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
CKS1 Antibody Blocking Peptide
orb1503372 500 µg

CKS1 Antibody Blocking Peptide

Sign In for Pricing
View Details