Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wasf2 Rabbit Polyclonal Antibody (FITC)

Wasf2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

WAV, WAVE2, AW742646, D4Ertd13, D4Ertd13e

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QNGSIGSVENVDAASYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPADN

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_700472

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Aminoisoquinolin-1 (2H) -one ≥97% (HPLC)
234511-01 100 mg

6-Aminoisoquinolin-1 (2H) -one ≥97% (HPLC)

Sign In for Pricing
View Details
6-Aminoisoquinolin-1 (2H) -one ≥97% (HPLC)
234511-02 250 mg

6-Aminoisoquinolin-1 (2H) -one ≥97% (HPLC)

Sign In for Pricing
View Details
6-Aminoisoquinolin-1 (2H) -one ≥97% (HPLC)
234511-03 1 g

6-Aminoisoquinolin-1 (2H) -one ≥97% (HPLC)

Sign In for Pricing
View Details
Anti-TNF alpha Antibody Picoband® (Cy3 Conjugate)
A00002-2-Cy3 100 µg/Vial

Anti-TNF alpha Antibody Picoband® (Cy3 Conjugate)

Sign In for Pricing
View Details
Lead (IV) Oxide
3123097 1 Each

Lead (IV) Oxide

Sign In for Pricing
View Details
Slc25a1 Rat Pre-designed siRNA Set A
HY-RS25067 1 Set

Slc25a1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details