Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNLL1 Rabbit Polyclonal Antibody (HRP)

DYNLL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LC8, PIN, DLC1, DLC8, LC8a, DNCL1, hdlc1, DNCLC1

UniProt

P63167

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DYNLL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001032583

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine BarH-like 1 homeobox protein (BARHL1) ELISA Kit
OM623728 96 Strip Well

Bovine BarH-like 1 homeobox protein (BARHL1) ELISA Kit

Sign In for Pricing
View Details
Sheep Prostaglandin D2 Receptor (PTGDR) ELISA Kit
MBS9927153-01 48 Well

Sheep Prostaglandin D2 Receptor (PTGDR) ELISA Kit

Sign In for Pricing
View Details
Sheep Prostaglandin D2 Receptor (PTGDR) ELISA Kit
MBS9927153-02 96 Well

Sheep Prostaglandin D2 Receptor (PTGDR) ELISA Kit

Sign In for Pricing
View Details
Sheep Prostaglandin D2 Receptor (PTGDR) ELISA Kit
MBS9927153-03 5x 96 Well

Sheep Prostaglandin D2 Receptor (PTGDR) ELISA Kit

Sign In for Pricing
View Details
Sheep Prostaglandin D2 Receptor (PTGDR) ELISA Kit
MBS9927153-04 10x 96 Well

Sheep Prostaglandin D2 Receptor (PTGDR) ELISA Kit

Sign In for Pricing
View Details
UNC0379 TFA 100mg
A22036-100 100 mg

UNC0379 TFA 100mg

Sign In for Pricing
View Details