Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JPH2 Rabbit Polyclonal Antibody (HRP)

JPH2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

JP2, JP-2, CMH17

UniProt

Q9BR39

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human JPH2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065166

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Difluorobenzyl alcohol
420229-01 500 mg

2,4-Difluorobenzyl alcohol

Sign In for Pricing
View Details
2,4-Difluorobenzyl alcohol
420229-02 1 g

2,4-Difluorobenzyl alcohol

Sign In for Pricing
View Details
Lentiviral human IKZF4 sgRNA gene knockout kit - Lentiviral human IKZF4 sgRNA gene knockout kit (100)
GTR15377278 1 Vial

Lentiviral human IKZF4 sgRNA gene knockout kit - Lentiviral human IKZF4 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Recombinant Lodderomyces elongisporus Long chronological lifespan protein 2 (LCL2)
MBS1024676-01 0.05 mg (E-Coli)

Recombinant Lodderomyces elongisporus Long chronological lifespan protein 2 (LCL2)

Sign In for Pricing
View Details
Recombinant Lodderomyces elongisporus Long chronological lifespan protein 2 (LCL2)
MBS1024676-02 0.05 mg (Yeast)

Recombinant Lodderomyces elongisporus Long chronological lifespan protein 2 (LCL2)

Sign In for Pricing
View Details
Recombinant Lodderomyces elongisporus Long chronological lifespan protein 2 (LCL2)
MBS1024676-03 0.2 mg (E-Coli)

Recombinant Lodderomyces elongisporus Long chronological lifespan protein 2 (LCL2)

Sign In for Pricing
View Details