Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNF1A Rabbit Polyclonal Antibody (FITC)

HNF1A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HNF1, LFB1, TCF1, HNF4A, MODY3, TCF-1, HNF-1A, IDDM20, HNF1alpha

UniProt

P20823

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HNF1A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_000536

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFP hsa-mir-200b AAV miRNA Vector
Amh1279300 500 ng

GFP hsa-mir-200b AAV miRNA Vector

Sign In for Pricing
View Details
Tuberin (TSC2) (NM_000548) Human Mutant ORF Clone
RC402408 10 µg

Tuberin (TSC2) (NM_000548) Human Mutant ORF Clone

Sign In for Pricing
View Details
Homeobox B9 Rabbit Monoclonal Antibody
E46F2115 40 µL

Homeobox B9 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Canine Solute Carrier Family 39, Member 6 ELISA Kit
MBS087809-01 48 Well

Canine Solute Carrier Family 39, Member 6 ELISA Kit

Sign In for Pricing
View Details
Canine Solute Carrier Family 39, Member 6 ELISA Kit
MBS087809-02 96 Well

Canine Solute Carrier Family 39, Member 6 ELISA Kit

Sign In for Pricing
View Details
Canine Solute Carrier Family 39, Member 6 ELISA Kit
MBS087809-03 5x 96 Well

Canine Solute Carrier Family 39, Member 6 ELISA Kit

Sign In for Pricing
View Details