Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNF1A Rabbit Polyclonal Antibody (HRP)

HNF1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HNF1, LFB1, TCF1, HNF4A, MODY3, TCF-1, HNF-1A, IDDM20, HNF1alpha

UniProt

P20823

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HNF1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_000536

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-Benzenedicarboxylic Acid Isodecyl Isononyl Ester
TRC-B565960-10MG 10 mg

1,2-Benzenedicarboxylic Acid Isodecyl Isononyl Ester

Sign In for Pricing
View Details
Rps21 Mouse Gene Knockout Kit (CRISPR)
KN515091 1 Kit

Rps21 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLEC4D (NM_080387) Human Recombinant Protein
TP307032L 1 mg

CLEC4D (NM_080387) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human AACS/Acetoacetyl-CoA Synthetase Protein (His Tag)
PKSH031250 100 µg

Recombinant Human AACS/Acetoacetyl-CoA Synthetase Protein (His Tag)

Sign In for Pricing
View Details
Rabl6 Mouse Gene Knockout Kit (CRISPR)
KN514401 1 Kit

Rabl6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PDCD1 / PD1 / CD279 (Programmed Cell Death 1), CF594 conjugate, 0.1mg/mL
BNC941457-100 1x 100 µL

PDCD1 / PD1 / CD279 (Programmed Cell Death 1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details