Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ac Rabbit Polyclonal Antibody (HRP)

Ac Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

990 E5 F1, Ac, AC, AS-C, AS-C T5, AS-C T5ac, ASC, ascT5, CG3796, Dmel\CG3796, EG:125H10.3, Hw, sc/T5, T5

UniProt

P10083

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Fruit fly

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_476824

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroid Stimulating Hormone, beta (TSH beta) (Pituitary Marker) (TSHb/1317), CF405S conjugate, 0.1mg/mL
BNC041317-500 1x 500 µL

Thyroid Stimulating Hormone, beta (TSH beta) (Pituitary Marker) (TSHb/1317), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PI 3 kinase p85 alpha Monoclonal Antibody
E-AB-22164-01 20 µL

PI 3 kinase p85 alpha Monoclonal Antibody

Sign In for Pricing
View Details
PI 3 kinase p85 alpha Monoclonal Antibody
E-AB-22164-02 60 µL

PI 3 kinase p85 alpha Monoclonal Antibody

Sign In for Pricing
View Details
PI 3 kinase p85 alpha Monoclonal Antibody
E-AB-22164-03 120 µL

PI 3 kinase p85 alpha Monoclonal Antibody

Sign In for Pricing
View Details
PI 3 kinase p85 alpha Monoclonal Antibody
E-AB-22164-04 200 µL

PI 3 kinase p85 alpha Monoclonal Antibody

Sign In for Pricing
View Details
CD43 (SPN/1094), Biotin conjugate, 0.1mg/mL
BNCB1094-500 1x 500 µL

CD43 (SPN/1094), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details