Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-omega 1, Human (HEK293, His)

IFN-omega protein is a member of the alpha/beta interferon family. IFN-omega 1 Protein, Human (HEK293, His) is the recombinant human-derived IFN-omega protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IFN-omega 1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-omega-protein-human-hek-293-his.html

Purity

95.0

Smiles

LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS

Molecular Formula

3467 (Gene_ID) P05000 (L22-S195) (Accession)

Molecular Weight

Approximately 21-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leukemia Inhibitory Factor Receptor (LIFR) Antibody
abx103736-01 100 µL

Leukemia Inhibitory Factor Receptor (LIFR) Antibody

Sign In for Pricing
View Details
Leukemia Inhibitory Factor Receptor (LIFR) Antibody
abx103736-02 200 µL

Leukemia Inhibitory Factor Receptor (LIFR) Antibody

Sign In for Pricing
View Details
Leukemia Inhibitory Factor Receptor (LIFR) Antibody
abx103736-03 1 mL

Leukemia Inhibitory Factor Receptor (LIFR) Antibody

Sign In for Pricing
View Details
Bovine Interleukin 6 (IL-6) ELISA Kit
YP-W77030-01 48 Tests

Bovine Interleukin 6 (IL-6) ELISA Kit

Sign In for Pricing
View Details
Bovine Interleukin 6 (IL-6) ELISA Kit
YP-W77030-02 96 Tests

Bovine Interleukin 6 (IL-6) ELISA Kit

Sign In for Pricing
View Details
Histone H3 (Di Methyl K36) Antibody, AbBy Fluor™ 350 Conjugated
bs-3769R-BF350-01 20 µL

Histone H3 (Di Methyl K36) Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details