Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLG Rabbit Polyclonal Antibody (FITC)

PLG Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P00747

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human PLMN

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPE

Field of Research

Cardiovascular Research

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

89kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000292

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

α, ω-Bis-Succinamic Acid NHS Ester PEG
1110000-35.1G 1 g

α, ω-Bis-Succinamic Acid NHS Ester PEG

Sign In for Pricing
View Details
Porcine Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit
RD-VEGFR2-p-01 96 Tests

Porcine Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit

Sign In for Pricing
View Details
Porcine Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit
RD-VEGFR2-p-02 48 Tests

Porcine Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit

Sign In for Pricing
View Details
Biotin Conjugated Arachis hypogaea Lectin (Peanut) -PNA-
BA-2301-1 1 mg

Biotin Conjugated Arachis hypogaea Lectin (Peanut) -PNA-

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS802383 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
EREG (NM_001432) Human Over-expression Lysate
LC419939 20 µg

EREG (NM_001432) Human Over-expression Lysate

Sign In for Pricing
View Details