Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EME2 Rabbit Polyclonal Antibody (HRP)

EME2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SLX2B, gs125

UniProt

A4GXA9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human EME2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TTARPHLAVIGLDAYLWSRQHVSRGTQQPESPKVAGAEVAVSWPEVEEVR

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001244299

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nucleotide-binding oligomerization domain-containing protein 2, NOD2 ELISA KIT
E2317Mo-01 48 Well

Mouse Nucleotide-binding oligomerization domain-containing protein 2, NOD2 ELISA KIT

Sign In for Pricing
View Details
Mouse Nucleotide-binding oligomerization domain-containing protein 2, NOD2 ELISA KIT
E2317Mo-02 96 Well

Mouse Nucleotide-binding oligomerization domain-containing protein 2, NOD2 ELISA KIT

Sign In for Pricing
View Details
Mouse Nucleotide-binding oligomerization domain-containing protein 2, NOD2 ELISA KIT
E2317Mo-03 5x 96 Tests

Mouse Nucleotide-binding oligomerization domain-containing protein 2, NOD2 ELISA KIT

Sign In for Pricing
View Details
Mouse Nucleotide-binding oligomerization domain-containing protein 2, NOD2 ELISA KIT
E2317Mo-04 10x 96 Tests

Mouse Nucleotide-binding oligomerization domain-containing protein 2, NOD2 ELISA KIT

Sign In for Pricing
View Details
alpha 1 Antitrypsin (SERPINA1) (NM_001127703) Human Tagged ORF Clone Lentiviral Particle
RC225658L3V 200 µL

alpha 1 Antitrypsin (SERPINA1) (NM_001127703) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GCP3 Polyclonal Antibody, FITC Conjugated
bs-13277R-FITC 100 µL

GCP3 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details