Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIP6 Rabbit Polyclonal Antibody (Biotin)

TRIP6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OIP1, OIP-1, ZRP-1, TRIP-6, TRIP6i2

UniProt

Q15654

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIP6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_003293

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,5-Difluoro-4-methoxyphenylboronic acid
420554-01 100 mg

2,5-Difluoro-4-methoxyphenylboronic acid

Sign In for Pricing
View Details
2,5-Difluoro-4-methoxyphenylboronic acid
420554-02 250 mg

2,5-Difluoro-4-methoxyphenylboronic acid

Sign In for Pricing
View Details
TPD52 siRNA (Human)
orb1863344-01 15 nmol

TPD52 siRNA (Human)

Sign In for Pricing
View Details
TPD52 siRNA (Human)
orb1863344-02 30 nmol

TPD52 siRNA (Human)

Sign In for Pricing
View Details
HLA-DQA2, ID (HLA-DQA2, HLA-DXA, HLA class II histocompatibility antigen, DQ alpha 2 chain, DX alpha chain, HLA class II histocompatibility antigen, DQ(6) alpha chain, HLA-DQA1, MHC class II DQA2) (AP)
MBS6307121-01 0.2 mL

HLA-DQA2, ID (HLA-DQA2, HLA-DXA, HLA class II histocompatibility antigen, DQ alpha 2 chain, DX alpha chain, HLA class II histocompatibility antigen, DQ(6) alpha chain, HLA-DQA1, MHC class II DQA2) (AP)

Sign In for Pricing
View Details
HLA-DQA2, ID (HLA-DQA2, HLA-DXA, HLA class II histocompatibility antigen, DQ alpha 2 chain, DX alpha chain, HLA class II histocompatibility antigen, DQ(6) alpha chain, HLA-DQA1, MHC class II DQA2) (AP)
MBS6307121-02 5x 0.2 mL

HLA-DQA2, ID (HLA-DQA2, HLA-DXA, HLA class II histocompatibility antigen, DQ alpha 2 chain, DX alpha chain, HLA class II histocompatibility antigen, DQ(6) alpha chain, HLA-DQA1, MHC class II DQA2) (AP)

Sign In for Pricing
View Details