Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Emx1 Rabbit Polyclonal Antibody (HRP)

Emx1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC129284, MGC129285

UniProt

Q04742

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLER

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034261

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Mediator of DNA damage checkpoint protein 1 (Mdc1) , partial
MBS1302410 Inquire

Recombinant Rat Mediator of DNA damage checkpoint protein 1 (Mdc1) , partial

Sign In for Pricing
View Details
MYO18B Antibody, HRP Conjugated
MBS7114199-01 0.05 mg

MYO18B Antibody, HRP Conjugated

Sign In for Pricing
View Details
MYO18B Antibody, HRP Conjugated
MBS7114199-02 0.1 mg

MYO18B Antibody, HRP Conjugated

Sign In for Pricing
View Details
MYO18B Antibody, HRP Conjugated
MBS7114199-03 5x 0.1 mg

MYO18B Antibody, HRP Conjugated

Sign In for Pricing
View Details
Bovine ZAR1-like protein, ZAR1L ELISA KIT
ELI-28800b 96 Tests

Bovine ZAR1-like protein, ZAR1L ELISA KIT

Sign In for Pricing
View Details
Rat Sipa1l2 Pre-designed siRNA Set B
SI212880B 1 Each

Rat Sipa1l2 Pre-designed siRNA Set B

Sign In for Pricing
View Details