Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Emx1 Rabbit Polyclonal Antibody (HRP)

Emx1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC129284, MGC129285

UniProt

Q04742

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLER

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034261

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr37 3'UTR GFP Stable Cell Line
TU265147 1.0 mL

Olr37 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RBPMS Mouse Monoclonal Antibody [Clone ID: LBI4H6]
AMM14452VCF 100 µg

RBPMS Mouse Monoclonal Antibody [Clone ID: LBI4H6]

Sign In for Pricing
View Details
NKG2D Biosimilar Antibody
orb2321972-01 50 µg

NKG2D Biosimilar Antibody

Sign In for Pricing
View Details
NKG2D Biosimilar Antibody
orb2321972-02 100 µg

NKG2D Biosimilar Antibody

Sign In for Pricing
View Details
MRT67307 HCl
S7948-1g 1 g

MRT67307 HCl

Sign In for Pricing
View Details
JIP2 Rabbit Polyclonal Antibody
orb157715-01 50 μL

JIP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details