Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLX Rabbit Polyclonal Antibody (HRP)

MLX Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TF4, MAD7, MXD7, TCFL4, bHLHd13

UniProt

Q9UH92

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MLX

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQEAYKESYKDRRR

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lusvertikimab Biosimilar (IL-7Ra / CD127 Reference Antibody)
orb2703903-01 1 mg

Lusvertikimab Biosimilar (IL-7Ra / CD127 Reference Antibody)

Sign In for Pricing
View Details
Lusvertikimab Biosimilar (IL-7Ra / CD127 Reference Antibody)
orb2703903-02 5 mg

Lusvertikimab Biosimilar (IL-7Ra / CD127 Reference Antibody)

Sign In for Pricing
View Details
Lusvertikimab Biosimilar (IL-7Ra / CD127 Reference Antibody)
orb2703903-03 100 mg

Lusvertikimab Biosimilar (IL-7Ra / CD127 Reference Antibody)

Sign In for Pricing
View Details
Human GCC1 qPCR Primer Pair
QH51549S 200 Tests

Human GCC1 qPCR Primer Pair

Sign In for Pricing
View Details
LHX6, CT (LHX6, LHX6.1, LIM/homeobox protein Lhx6, LIM/homeobox protein Lhx6.1) (PE) discontinued
037770-PE 200 µL

LHX6, CT (LHX6, LHX6.1, LIM/homeobox protein Lhx6, LIM/homeobox protein Lhx6.1) (PE) discontinued

Sign In for Pricing
View Details
Recombinant Human Calsequestrin
MBS143955-01 0.005 mg

Recombinant Human Calsequestrin

Sign In for Pricing
View Details