Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFT172 Rabbit Polyclonal Antibody (Biotin)

IFT172 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SLB, wim, RP71, BBS20, osm-1, NPHP17, SRTD10

UniProt

Q9UG01

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IFT172

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VKILGKERYLVAHTSETLLLGDLNTNRLSEIAWQGSGGNEKYFFENENVC

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

197kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056477

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMURF2, NT (E3 Ubiquitin-protein Ligase SMURF2, Smad Ubiquitination Regulatory Factor 2, Ubiquitin-protein Ligase SMURF2, Smad-specific E3 Ubiquitin Ligase 2, hSMURF2) (PE)
MBS6499929-01 0.2 mL

SMURF2, NT (E3 Ubiquitin-protein Ligase SMURF2, Smad Ubiquitination Regulatory Factor 2, Ubiquitin-protein Ligase SMURF2, Smad-specific E3 Ubiquitin Ligase 2, hSMURF2) (PE)

Sign In for Pricing
View Details
SMURF2, NT (E3 Ubiquitin-protein Ligase SMURF2, Smad Ubiquitination Regulatory Factor 2, Ubiquitin-protein Ligase SMURF2, Smad-specific E3 Ubiquitin Ligase 2, hSMURF2) (PE)
MBS6499929-02 5x 0.2 mL

SMURF2, NT (E3 Ubiquitin-protein Ligase SMURF2, Smad Ubiquitination Regulatory Factor 2, Ubiquitin-protein Ligase SMURF2, Smad-specific E3 Ubiquitin Ligase 2, hSMURF2) (PE)

Sign In for Pricing
View Details
CRAMP1L Protein Vector (Mouse) (pPM-C-HA)
PV167864 500 ng

CRAMP1L Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Human Gametocyte-specific factor 1 (GTSF1)
MBS1460649-01 0.02 mg (E-Coli)

Recombinant Human Gametocyte-specific factor 1 (GTSF1)

Sign In for Pricing
View Details
Recombinant Human Gametocyte-specific factor 1 (GTSF1)
MBS1460649-02 0.1 mg (E-Coli)

Recombinant Human Gametocyte-specific factor 1 (GTSF1)

Sign In for Pricing
View Details
Recombinant Human Gametocyte-specific factor 1 (GTSF1)
MBS1460649-03 0.02 mg (Yeast)

Recombinant Human Gametocyte-specific factor 1 (GTSF1)

Sign In for Pricing
View Details