Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF562 Rabbit Polyclonal Antibody (Biotin)

ZNF562 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

P0C7V5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ZNF562

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CKECGQAFTQYTGLAIHIRNHTGEKPYQCKECGKAFNRSSTLTQHRRIHT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal West Nile Virus C Protein Antibody [DyLight 650]
NBP2-41054C 0.1 mL

Rabbit Polyclonal West Nile Virus C Protein Antibody [DyLight 650]

Sign In for Pricing
View Details
Methyl 3-O-benzyl-4,6-O-benzylidene-2-deoxy-2-phthalimido-b-D-glucopyranose
294061-01 250 mg

Methyl 3-O-benzyl-4,6-O-benzylidene-2-deoxy-2-phthalimido-b-D-glucopyranose

Sign In for Pricing
View Details
Methyl 3-O-benzyl-4,6-O-benzylidene-2-deoxy-2-phthalimido-b-D-glucopyranose
294061-02 500 mg

Methyl 3-O-benzyl-4,6-O-benzylidene-2-deoxy-2-phthalimido-b-D-glucopyranose

Sign In for Pricing
View Details
Methyl 3-O-benzyl-4,6-O-benzylidene-2-deoxy-2-phthalimido-b-D-glucopyranose
294061-03 1 g

Methyl 3-O-benzyl-4,6-O-benzylidene-2-deoxy-2-phthalimido-b-D-glucopyranose

Sign In for Pricing
View Details
ZNF174 siRNA (h)
sc-93459 10 µM

ZNF174 siRNA (h)

Sign In for Pricing
View Details
NUP133 (Nuclear Pore Complex Protein Nup133, Nucleoporin Nup133, Nucleoporin 133kDa, 133kD Nucleoporin, hNUP133, FLJ10814, MGC21133) (MaxLight 750) discontinued
130648-ML750 100 µL

NUP133 (Nuclear Pore Complex Protein Nup133, Nucleoporin Nup133, Nucleoporin 133kDa, 133kD Nucleoporin, hNUP133, FLJ10814, MGC21133) (MaxLight 750) discontinued

Sign In for Pricing
View Details