Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF562 Rabbit Polyclonal Antibody (HRP)

ZNF562 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P0C7V5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ZNF562

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CKECGQAFTQYTGLAIHIRNHTGEKPYQCKECGKAFNRSSTLTQHRRIHT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX2-4 CRISPR All-in-one AAV vector set (with saCas9)(Human)
31883151 3x 1.0 µg DNA

NKX2-4 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Human Interleukin 4 (IL4) ELISA Kit DIY Materials
MBS2088370-01 5x 96 Tests

Human Interleukin 4 (IL4) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Human Interleukin 4 (IL4) ELISA Kit DIY Materials
MBS2088370-02 5x 96 Tests + MBS2089471 (Support Pack 1,5x 96 Tests)

Human Interleukin 4 (IL4) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Human Interleukin 4 (IL4) ELISA Kit DIY Materials
MBS2088370-03 10x 96 Tests

Human Interleukin 4 (IL4) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Human Interleukin 4 (IL4) ELISA Kit DIY Materials
MBS2088370-04 10x 96 Tests + MBS2089471 (Support Pack 1, 10x 96 Tests)

Human Interleukin 4 (IL4) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Cathepsin L Rabbit Polyclonal Antibody (BF594)
orb2423143 100 µL

Cathepsin L Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details