Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF562 Rabbit Polyclonal Antibody (HRP)

ZNF562 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P0C7V5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ZNF562

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CKECGQAFTQYTGLAIHIRNHTGEKPYQCKECGKAFNRSSTLTQHRRIHT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SARS-CoV-2 ORF9b Antibody [Janelia Fluor 549]
NBP3-07036JF549 0.1 mL

Rabbit Polyclonal SARS-CoV-2 ORF9b Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
PTP4A2 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-0644R-BF405 100 µL

PTP4A2 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
IBT6A hydrochloride 50mg
A21865-50 50 mg

IBT6A hydrochloride 50mg

Sign In for Pricing
View Details
Recombinant Human IQGAP2 Protein - (Dry Ice)
H00010788-Q01-10ug 10 µg

Recombinant Human IQGAP2 Protein - (Dry Ice)

Sign In for Pricing
View Details
Cortisol Urine EIA
RE52241 96 Determinations

Cortisol Urine EIA

Sign In for Pricing
View Details
Lentiviral mouse Tbca shRNA (UAS) - Lentiviral mouse Tbca shRNA (UAS, RFP) plasmid
GTR15146917 1 Vial

Lentiviral mouse Tbca shRNA (UAS) - Lentiviral mouse Tbca shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details