Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FHL5 Rabbit Polyclonal Antibody (HRP)

FHL5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ACT, FHL-5, dJ393D12.2, 1700027G07Rik

UniProt

Q5TD97

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FHL5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065228

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycophorin A / CD235a (Erythrocyte Marker) (rGYPA/280), CF647 conjugate, 0.1mg/mL
BNC471868-100 1x 100 µL

Glycophorin A / CD235a (Erythrocyte Marker) (rGYPA/280), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB527514 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
Tropic Acid
TRC-T892620-1G 1 g

Tropic Acid

Sign In for Pricing
View Details
p53 (TP53) Mouse Monoclonal Antibody [Clone ID: IMD-53]
AM20653PU-N 100 µg

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: IMD-53]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB557714 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS629486 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details