Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FHL5 Rabbit Polyclonal Antibody (HRP)

FHL5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ACT, FHL-5, dJ393D12.2, 1700027G07Rik

UniProt

Q5TD97

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FHL5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065228

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mutarotase (GALM) (NM_138801) Human Recombinant Protein
TP720250L 500 µg

Mutarotase (GALM) (NM_138801) Human Recombinant Protein

Sign In for Pricing
View Details
PE Anti-Mouse CD14 Antibody[Sa14-2]
E-AB-F1176D-01 50 Tests

PE Anti-Mouse CD14 Antibody[Sa14-2]

Sign In for Pricing
View Details
PE Anti-Mouse CD14 Antibody[Sa14-2]
E-AB-F1176D-02 100 Tests

PE Anti-Mouse CD14 Antibody[Sa14-2]

Sign In for Pricing
View Details
PE Anti-Mouse CD14 Antibody[Sa14-2]
E-AB-F1176D-03 2x 100 Tests

PE Anti-Mouse CD14 Antibody[Sa14-2]

Sign In for Pricing
View Details
ROR gamma (RORC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G3]
TA809592AM 100 µL

ROR gamma (RORC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G3]

Sign In for Pricing
View Details
Human TTC27 activation kit by CRISPRa
GA110831 1 Kit

Human TTC27 activation kit by CRISPRa

Sign In for Pricing
View Details