Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHDC5 Rabbit Polyclonal Antibody (HRP)

KLHDC5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ctb9, KLHDC5

UniProt

Q9P2K6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLHDC5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LQEACLRFMVVHFHEVLCKPQFHLLGSPPQAPGDVSLKQRLREARMTGTP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065833

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Cell invasion protein sipB (sipB)
orb2923294-01 20 µg

Recombinant Cell invasion protein sipB (sipB)

Sign In for Pricing
View Details
Recombinant Cell invasion protein sipB (sipB)
orb2923294-02 100 µg

Recombinant Cell invasion protein sipB (sipB)

Sign In for Pricing
View Details
BMP-3 Polyclonal Antibody
orb310190-01 50 μL

BMP-3 Polyclonal Antibody

Sign In for Pricing
View Details
BMP-3 Polyclonal Antibody
orb310190-02 100 µL

BMP-3 Polyclonal Antibody

Sign In for Pricing
View Details
Rat NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) ELISA Kit
MBS7212432-01 48 Well

Rat NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) ELISA Kit

Sign In for Pricing
View Details
Rat NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) ELISA Kit
MBS7212432-02 96 Well

Rat NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) ELISA Kit

Sign In for Pricing
View Details