Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INTS4 Rabbit Polyclonal Antibody (Biotin)

INTS4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

INT4, MST093

UniProt

Q96HW7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human INTS4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PAEVVKILQTMLRQSAFLHLPLPEQIHKASATIIEPAGESDNPLRFTSGL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

108kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_291025

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT18, CT (Keratin, Type I Cytoskeletal 18, Cytokeratin-18, CK-18, Keratin-18, K18, Cell Proliferation-inducing Gene 46 Protein, PIG46, CYK18)
MBS642572-01 0.05 mL

KRT18, CT (Keratin, Type I Cytoskeletal 18, Cytokeratin-18, CK-18, Keratin-18, K18, Cell Proliferation-inducing Gene 46 Protein, PIG46, CYK18)

Sign In for Pricing
View Details
KRT18, CT (Keratin, Type I Cytoskeletal 18, Cytokeratin-18, CK-18, Keratin-18, K18, Cell Proliferation-inducing Gene 46 Protein, PIG46, CYK18)
MBS642572-02 5x 0.05 mL

KRT18, CT (Keratin, Type I Cytoskeletal 18, Cytokeratin-18, CK-18, Keratin-18, K18, Cell Proliferation-inducing Gene 46 Protein, PIG46, CYK18)

Sign In for Pricing
View Details
Mouse Or5k3 qPCR Primer Pair
QM67810S 200 Tests

Mouse Or5k3 qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Pyrococcus furiosus Asparagine--tRNA ligase (asnS)
MBS1377441-01 0.02 mg (E-Coli)

Recombinant Pyrococcus furiosus Asparagine--tRNA ligase (asnS)

Sign In for Pricing
View Details
Recombinant Pyrococcus furiosus Asparagine--tRNA ligase (asnS)
MBS1377441-02 0.02 mg (Yeast)

Recombinant Pyrococcus furiosus Asparagine--tRNA ligase (asnS)

Sign In for Pricing
View Details
Recombinant Pyrococcus furiosus Asparagine--tRNA ligase (asnS)
MBS1377441-03 0.1 mg (E-Coli)

Recombinant Pyrococcus furiosus Asparagine--tRNA ligase (asnS)

Sign In for Pricing
View Details