Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF526 Rabbit Polyclonal Antibody (HRP)

ZNF526 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZp762O059, KIAA1951, MGC4267

UniProt

Q8TF50

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF526

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DCGKRFTQSSNLQQHRRLHLRPVAFARAPRLPITGLYNKSPYYCGTCGRW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_597701

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALB (Albumin, Serum Albumin, GIG20, GIG42, PRO0903, PRO1708, PRO2044, PRO2619, PRO2675, UNQ696/PRO1341) (HRP)
MBS6369411-01 0.1 mL

ALB (Albumin, Serum Albumin, GIG20, GIG42, PRO0903, PRO1708, PRO2044, PRO2619, PRO2675, UNQ696/PRO1341) (HRP)

Sign In for Pricing
View Details
ALB (Albumin, Serum Albumin, GIG20, GIG42, PRO0903, PRO1708, PRO2044, PRO2619, PRO2675, UNQ696/PRO1341) (HRP)
MBS6369411-02 5x 0.1 mL

ALB (Albumin, Serum Albumin, GIG20, GIG42, PRO0903, PRO1708, PRO2044, PRO2619, PRO2675, UNQ696/PRO1341) (HRP)

Sign In for Pricing
View Details
Beta tubulin Mouse mAb, Cy5.5 conjugated
orb2873681 100 µL

Beta tubulin Mouse mAb, Cy5.5 conjugated

Sign In for Pricing
View Details
Insig1, NT (Insulin-induced gene 1 protein, INSIG-1, CL6, CL-6, MGC1405) (MaxLight 750) discontinued
I7655-85N-ML750 100 µL

Insig1, NT (Insulin-induced gene 1 protein, INSIG-1, CL6, CL-6, MGC1405) (MaxLight 750) discontinued

Sign In for Pricing
View Details
RPS27A (Ribosomal Protein S27a, CEP80, HUBCEP80, UBA80, UBCEP1, UBCEP80) (MaxLight 550)
251278-ML550 100 µL

RPS27A (Ribosomal Protein S27a, CEP80, HUBCEP80, UBA80, UBCEP1, UBCEP80) (MaxLight 550)

Sign In for Pricing
View Details
SAMD9L Rabbit Polyclonal Antibody
orb3070432-01 30 µL

SAMD9L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details