Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF681 Rabbit Polyclonal Antibody (FITC)

ZNF681 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ31526

UniProt

P59817

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF681

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PWTRKRHRMVAEPPVICSHFAQDFSPEQNIKDSFQKVTPRRYGKCEHENL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_612143

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PI3KC3 (S282) (Phosphatidylinositol 3-kinase catalytic subunit type 3, PtdIns-3-kinase type 3, PI3-kinase type 3, PI3K type 3, Phosphoinositide-3-kinase class 3, Phosphatidylinositol 3-kinase p100 subunit, vps34) (Azide free) (HRP) discontinued
039978-HRP 200 µL

PI3KC3 (S282) (Phosphatidylinositol 3-kinase catalytic subunit type 3, PtdIns-3-kinase type 3, PI3-kinase type 3, PI3K type 3, Phosphoinositide-3-kinase class 3, Phosphatidylinositol 3-kinase p100 subunit, vps34) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Recombinant Human Thymic Stromal Lymphopoietin/TSLP Protein
ARP5720-01 10 µg

Recombinant Human Thymic Stromal Lymphopoietin/TSLP Protein

Sign In for Pricing
View Details
Recombinant Human Thymic Stromal Lymphopoietin/TSLP Protein
ARP5720-02 50 µg

Recombinant Human Thymic Stromal Lymphopoietin/TSLP Protein

Sign In for Pricing
View Details
Recombinant Human Thymic Stromal Lymphopoietin/TSLP Protein
ARP5720-03 100 µg

Recombinant Human Thymic Stromal Lymphopoietin/TSLP Protein

Sign In for Pricing
View Details
Recombinant Human Thymic Stromal Lymphopoietin/TSLP Protein
ARP5720-04 1 mg

Recombinant Human Thymic Stromal Lymphopoietin/TSLP Protein

Sign In for Pricing
View Details
USP1, NT (Ubiquitin Carboxyl-terminal Hydrolase 1, Ubiquitin Thioesterase 1, Ubiquitin-specific-processing Protease 1, Deubiquitinating Enzyme 1, hUBP) (PE) discontinued
U4099-59-PE 200 µL

USP1, NT (Ubiquitin Carboxyl-terminal Hydrolase 1, Ubiquitin Thioesterase 1, Ubiquitin-specific-processing Protease 1, Deubiquitinating Enzyme 1, hUBP) (PE) discontinued

Sign In for Pricing
View Details