Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFSD3 Rabbit Polyclonal Antibody (HRP)

MFSD3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q96ES6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MFSD3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALLSLCLQHFLGGLVTTVTFTGMMRCSQLAPRALQATHYSLLATLELLGK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_612440

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human GTF2I repeat domain containing 1 polyclonal Antibody
MBS711701-01 0.1 mL

Rabbit anti-human GTF2I repeat domain containing 1 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human GTF2I repeat domain containing 1 polyclonal Antibody
MBS711701-02 5x 0.1 mL

Rabbit anti-human GTF2I repeat domain containing 1 polyclonal Antibody

Sign In for Pricing
View Details
pCMV-SPORT6-Gad2 Plasmid
PVT53816 2 µg

pCMV-SPORT6-Gad2 Plasmid

Sign In for Pricing
View Details
Fish Paired Box Gene 6 ELISA Kit
MBS059499 Inquire

Fish Paired Box Gene 6 ELISA Kit

Sign In for Pricing
View Details
Recombinant Baumannia cicadellinicola subsp. Homalodisca coagulata Adenylate kinase (adk)
MBS1411284-01 0.02 mg (E-Coli)

Recombinant Baumannia cicadellinicola subsp. Homalodisca coagulata Adenylate kinase (adk)

Sign In for Pricing
View Details
Recombinant Baumannia cicadellinicola subsp. Homalodisca coagulata Adenylate kinase (adk)
MBS1411284-02 0.1 mg (E-Coli)

Recombinant Baumannia cicadellinicola subsp. Homalodisca coagulata Adenylate kinase (adk)

Sign In for Pricing
View Details