Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEPDC7 Rabbit Polyclonal Antibody (HRP)

DEPDC7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TR2, dJ85M6.4

UniProt

Q95JW3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DEPDC7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGKDKKPTFEDSSCSLYRFTTIPNQDSQLGKENKLYSPARYADALFKSSD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_631899

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Oryza sativa subsp. japonica (Rice) Os08g0191100 Polyclonal Antibody
MBS7197984 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) Os08g0191100 Polyclonal Antibody

Sign In for Pricing
View Details
AKR7L Antibody (N-Term)
E45R33213G-4 50 µL

AKR7L Antibody (N-Term)

Sign In for Pricing
View Details
SLC9A6 (Solute Carrier Family 9 Member 6, KIAA0267, MRSA, Sodium/hydrogen Exchanger 6, Na (+) /H (+) Exchanger 6, NHE6, NHE-6) (Biotin)
133519-Biotin 100 µL

SLC9A6 (Solute Carrier Family 9 Member 6, KIAA0267, MRSA, Sodium/hydrogen Exchanger 6, Na (+) /H (+) Exchanger 6, NHE6, NHE-6) (Biotin)

Sign In for Pricing
View Details
Bovine Interleukin 15 (IL15) ELISA Kit
RD-IL15-b-01 96 Tests

Bovine Interleukin 15 (IL15) ELISA Kit

Sign In for Pricing
View Details
Bovine Interleukin 15 (IL15) ELISA Kit
RD-IL15-b-02 48 Tests

Bovine Interleukin 15 (IL15) ELISA Kit

Sign In for Pricing
View Details
Olfr1328 AAV siRNA Pooled Vector
32780164 1.0 µg

Olfr1328 AAV siRNA Pooled Vector

Sign In for Pricing
View Details