Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEPDC7 Rabbit Polyclonal Antibody (FITC)

DEPDC7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TR2, dJ85M6.4

UniProt

Q96QD5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DEPDC7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EAVPTKVFGKDKKPTFEDSSCSLYRFTTIPNQDSQLGKENKLYSPARYAD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_631899

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NUCB2 Protein (Gst Tag)
PDEH100586-01 20 µg

Recombinant Human NUCB2 Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Human NUCB2 Protein (Gst Tag)
PDEH100586-02 100 µg

Recombinant Human NUCB2 Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Human NUCB2 Protein (Gst Tag)
PDEH100586-03 500 µg

Recombinant Human NUCB2 Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Human NUCB2 Protein (Gst Tag)
PDEH100586-04 1 mg

Recombinant Human NUCB2 Protein (Gst Tag)

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1671), Biotin conjugate, 0.1mg/mL
BNCB1671-100 1x 100 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1671), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/3309), CF647 conjugate, 0.1mg/mL
BNC473309-100 1x 100 µL

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/3309), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details