Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF480 Rabbit Polyclonal Antibody (HRP)

ZNF480 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

F8WEZ9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human ZNF480

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CLQEMSSSVKTPIFNRNDFDDSSFLPQEQKVHLREKPYECNEHSKVFRVS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001284553.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNBP, Recombinant, Human, aa1-170, His-Tag (Cellular Nucleic Acid-binding Protein, CNBP1, DM2, PROMM, RNF163, ZCCHC22, ZNF9)
137026-01 100 µg

CNBP, Recombinant, Human, aa1-170, His-Tag (Cellular Nucleic Acid-binding Protein, CNBP1, DM2, PROMM, RNF163, ZCCHC22, ZNF9)

Sign In for Pricing
View Details
CNBP, Recombinant, Human, aa1-170, His-Tag (Cellular Nucleic Acid-binding Protein, CNBP1, DM2, PROMM, RNF163, ZCCHC22, ZNF9)
137026-02 500 µg

CNBP, Recombinant, Human, aa1-170, His-Tag (Cellular Nucleic Acid-binding Protein, CNBP1, DM2, PROMM, RNF163, ZCCHC22, ZNF9)

Sign In for Pricing
View Details
TNFA (Tumor Necrosis Factor, Cachectin, TNF-alpha, Tumor Necrosis Factor Ligand Superfamily Member 2, TNF-a, TNF, TNFSF2) (AP)
MBS6403100-01 0.1 mL

TNFA (Tumor Necrosis Factor, Cachectin, TNF-alpha, Tumor Necrosis Factor Ligand Superfamily Member 2, TNF-a, TNF, TNFSF2) (AP)

Sign In for Pricing
View Details
TNFA (Tumor Necrosis Factor, Cachectin, TNF-alpha, Tumor Necrosis Factor Ligand Superfamily Member 2, TNF-a, TNF, TNFSF2) (AP)
MBS6403100-02 5x 0.1 mL

TNFA (Tumor Necrosis Factor, Cachectin, TNF-alpha, Tumor Necrosis Factor Ligand Superfamily Member 2, TNF-a, TNF, TNFSF2) (AP)

Sign In for Pricing
View Details
Human UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1) ELISA Kit
MBS8803279-01 48 Well

Human UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1) ELISA Kit

Sign In for Pricing
View Details
Human UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1) ELISA Kit
MBS8803279-02 96 Well

Human UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1) ELISA Kit

Sign In for Pricing
View Details