Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSX2B Rabbit Polyclonal Antibody (HRP)

SSX2B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SSX, CT5.2, CT5.2b, HOM-MEL-40

UniProt

Q16385

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SSX2B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IQKAFDDIAKYFSKEEWEKMKASEKIFYVYMKRKYEAMTKLGFKATLPPF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Porcine

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse E3 ubiquitin-protein ligase RFWD3, RFWD3 ELISA Kit
MBS9329855-01 48 Well

Mouse E3 ubiquitin-protein ligase RFWD3, RFWD3 ELISA Kit

Sign In for Pricing
View Details
Mouse E3 ubiquitin-protein ligase RFWD3, RFWD3 ELISA Kit
MBS9329855-02 96 Well

Mouse E3 ubiquitin-protein ligase RFWD3, RFWD3 ELISA Kit

Sign In for Pricing
View Details
Mouse E3 ubiquitin-protein ligase RFWD3, RFWD3 ELISA Kit
MBS9329855-03 5x 96 Well

Mouse E3 ubiquitin-protein ligase RFWD3, RFWD3 ELISA Kit

Sign In for Pricing
View Details
Mouse E3 ubiquitin-protein ligase RFWD3, RFWD3 ELISA Kit
MBS9329855-04 10x 96 Well

Mouse E3 ubiquitin-protein ligase RFWD3, RFWD3 ELISA Kit

Sign In for Pricing
View Details
Hsa-miR-501-5p miRNA Antagomir
orb1916008-01 10 nmol

Hsa-miR-501-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-501-5p miRNA Antagomir
orb1916008-02 20 nmol

Hsa-miR-501-5p miRNA Antagomir

Sign In for Pricing
View Details