Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBF4 Rabbit Polyclonal Antibody (HRP)

EBF4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

COE4, O/E-4

UniProt

Q9BQW3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human EBF4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVPGSPSFLNGSTATSPFAKERLRPRAAPPKLPTPGLPQSPRRGASRPVF

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse

Tested Applications

WB

NCBI Accession Number

XP_044921

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOBEC3B (PHO3) Antibody (C-term) Blocking peptide
MBS9219987-01 0.5 mg

APOBEC3B (PHO3) Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
APOBEC3B (PHO3) Antibody (C-term) Blocking peptide
MBS9219987-02 5x 0.5 mg

APOBEC3B (PHO3) Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
Lentiviral human PLEC sgRNA gene knockout kit - Lentiviral human PLEC sgRNA gene knockout kit (plasmid)
GTR15357467 1 Vial

Lentiviral human PLEC sgRNA gene knockout kit - Lentiviral human PLEC sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Recombinant Cluster Of Differentiation 200 (CD200)
TRV-0008465-01 10 µg

Recombinant Cluster Of Differentiation 200 (CD200)

Sign In for Pricing
View Details
Recombinant Cluster Of Differentiation 200 (CD200)
TRV-0008465-02 50 µg

Recombinant Cluster Of Differentiation 200 (CD200)

Sign In for Pricing
View Details
Recombinant Cluster Of Differentiation 200 (CD200)
TRV-0008465-03 100 µg

Recombinant Cluster Of Differentiation 200 (CD200)

Sign In for Pricing
View Details