Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CROCCL2 Rabbit Polyclonal Antibody (Biotin)

CROCCL2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CROCCL2, dJ798A10.2

UniProt

Q8IVE0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CROCCL2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NPEKDQVNTDLTEKLEALGTWHSPSCRTQSGVQLSGSERTADDSFGSLRG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_057040

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse 1700007K13Rik shRNA (UAS) - Lentiviral mouse 1700007K13Rik shRNA (UAS, GFP) plasmid
GTR15271762 1 Vial

Lentiviral mouse 1700007K13Rik shRNA (UAS) - Lentiviral mouse 1700007K13Rik shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Fibroblast growth factor 3
orb1641360-01 50 µg

Fibroblast growth factor 3

Sign In for Pricing
View Details
Fibroblast growth factor 3
orb1641360-02 100 µg

Fibroblast growth factor 3

Sign In for Pricing
View Details
Fibroblast growth factor 3
orb1641360-03 1 mg

Fibroblast growth factor 3

Sign In for Pricing
View Details
Lentiviral mouse Rhox10 shRNA (UAS) - Lentiviral mouse Rhox10 shRNA (UAS, iRFP) (25)
GTR15284870 1 Vial

Lentiviral mouse Rhox10 shRNA (UAS) - Lentiviral mouse Rhox10 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
KH domain-containing (RNA-binding (Signal transduction-associated protein 1 (KHDRBS1) Rat ELISA Kit
E5276 96 Tests

KH domain-containing (RNA-binding (Signal transduction-associated protein 1 (KHDRBS1) Rat ELISA Kit

Sign In for Pricing
View Details